DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and GDAP1L1

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001243666.1 Gene:GDAP1L1 / 78997 HGNCID:4213 Length:386 Species:Homo sapiens


Alignment Length:198 Identity:36/198 - (18%)
Similarity:71/198 - (35%) Gaps:62/198 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWD 67
            :||...:.|......::..||  |.|.:.:.:|.....|||..||.|..:.....||.|.     
Human   185 ELTTDSMIPKYATAEIRRHLA--NATTDLMKLDHEEEPQLSEPYLSKQKKLMAKILEHDD----- 242

  Fly    68 SHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQTKVPKERY 132
                ::||                                         |.:|  |:..:..::.
Human   243 ----VSYL-----------------------------------------KKIL--GELAMVLDQI 260

  Fly   133 DAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKY------PRIGAWIKK 191
            :|.:|.........|.:.::.|...|:||..|.:::..|: |:.| :.||      |.:.::.::
Human   261 EAELEKRKLENEGQKCELWLCGCAFTLADVLLGATLHRLK-FLGL-SKKYWEDGSRPNLQSFFER 323

  Fly   192 LEQ 194
            :::
Human   324 VQR 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 36/197 (18%)
GST_N_Delta_Epsilon 4..77 CDD:239343 19/72 (26%)
GST_C_Delta_Epsilon 91..209 CDD:198287 17/110 (15%)
GDAP1L1NP_001243666.1 GstA 47..333 CDD:223698 36/198 (18%)
GST_N_GDAP1 47..119 CDD:239350
GST_C_GDAP1L1 220..330 CDD:198335 28/161 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154535
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.