Sequence 1: | NP_611328.1 | Gene: | GstE6 / 37111 | FlyBaseID: | FBgn0063494 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001243666.1 | Gene: | GDAP1L1 / 78997 | HGNCID: | 4213 | Length: | 386 | Species: | Homo sapiens |
Alignment Length: | 198 | Identity: | 36/198 - (18%) |
---|---|---|---|
Similarity: | 71/198 - (35%) | Gaps: | 62/198 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KLTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWD 67
Fly 68 SHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQTKVPKERY 132
Fly 133 DAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKY------PRIGAWIKK 191
Fly 192 LEQ 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE6 | NP_611328.1 | GstA | 4..196 | CDD:223698 | 36/197 (18%) |
GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 19/72 (26%) | ||
GST_C_Delta_Epsilon | 91..209 | CDD:198287 | 17/110 (15%) | ||
GDAP1L1 | NP_001243666.1 | GstA | 47..333 | CDD:223698 | 36/198 (18%) |
GST_N_GDAP1 | 47..119 | CDD:239350 | |||
GST_C_GDAP1L1 | 220..330 | CDD:198335 | 28/161 (17%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165154535 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |