DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and gdap1l1

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001072239.1 Gene:gdap1l1 / 779687 XenbaseID:XB-GENE-950543 Length:364 Species:Xenopus tropicalis


Alignment Length:85 Identity:19/85 - (22%)
Similarity:34/85 - (40%) Gaps:2/85 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDS 68
            |.||....|...:.::|.:|......:..:|.:.......|.::..|....||.:....:.|.|.
 Frog    45 LVLYHWTQSFSSQKIRLVIAEKGFPCDERDVSLPLTEHKEPWFMRLNLGEEVPVVIHGDNIISDY 109

  Fly    69 HAIIAYLVSKYADSDALYPK 88
            :.||.|:.:.:...  |.||
 Frog   110 NQIIDYIENNFVGE--LIPK 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 19/85 (22%)
GST_N_Delta_Epsilon 4..77 CDD:239343 16/72 (22%)
GST_C_Delta_Epsilon 91..209 CDD:198287
gdap1l1NP_001072239.1 Thioredoxin_like 45..117 CDD:381987 16/71 (23%)
GST_C_family 198..308 CDD:383119
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.