DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and Gstt4

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001103145.1 Gene:Gstt4 / 686922 RGDID:1591294 Length:240 Species:Rattus norvegicus


Alignment Length:198 Identity:54/198 - (27%)
Similarity:92/198 - (46%) Gaps:26/198 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDSHAIIAYLV 76
            |.|.|||.:......:.:::..||::.....|.||:|.||...||:|.|....:.:|.||:.||.
  Rat    11 SAPCRAVYIFARKNGIPFDFQFVDLLKGHHHSKEYIEINPLRKVPSLRDGKFILSESVAILCYLC 75

  Fly    77 SKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSV-------LFQGQTKVPKERYDA 134
            .||:.....||.|...||.||:.:.::...:..    .:||.:       :..|: :||.||.|.
  Rat    76 RKYSAPSHWYPPDLHMRARVDEFMAWQHTAIQV----PMSKILWIKLIIPMITGE-EVPTERLDK 135

  Fly   135 IIE-----IYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTK----YPRIGAWIK 190
            .::     |..|.|.||:.:.:|.|:.:::||.     ||.:|....:.|..    ..::..|..
  Rat   136 TLDEVNKNIKQFEEKFLQDKLFITGDHISLADL-----VALVEMMQPMGTNHNVFISSKLAEWRM 195

  Fly   191 KLE 193
            ::|
  Rat   196 RVE 198

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 54/198 (27%)
GST_N_Delta_Epsilon 4..77 CDD:239343 22/64 (34%)
GST_C_Delta_Epsilon 91..209 CDD:198287 27/119 (23%)
Gstt4NP_001103145.1 GST_N_Theta 3..78 CDD:239348 22/66 (33%)