DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and Gsto2

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_080895.2 Gene:Gsto2 / 68214 MGIID:1915464 Length:248 Species:Mus musculus


Alignment Length:204 Identity:44/204 - (21%)
Similarity:88/204 - (43%) Gaps:27/204 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPE-YLEKNPQHTVPTLEDDG-HYIW 66
            :.:|.:...|.....:|.|.|..:.:|.:|:::.::    |: |..|:|...:|.||:.. ..::
Mouse    24 IRIYSMRFCPYSHRARLVLKAKGIRHEVININLKSK----PDWYYTKHPFGQIPVLENSQCQLVY 84

  Fly    67 DSHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQ-------GQ 124
            :|.....||...| ....|:|.||.:||  .|::..|   :|.. :..:||..|..       ..
Mouse    85 ESVIACEYLDDVY-PGRKLFPYDPYERA--RQKMLLE---LFCK-VPPLSKECLIALRCGRDCTD 142

  Fly   125 TKVP-KERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKY-PRIGA 187
            .||. ::....:.||.::..|     .:..|:.:::.|:.:......|:.:...|...: |.:..
Mouse   143 LKVALRQELCNMEEILEYQNT-----TFFGGDCISMIDYLVWPWFERLDVYGLADCVNHTPMLRL 202

  Fly   188 WIKKLEQLP 196
            ||..::|.|
Mouse   203 WIASMKQDP 211

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 43/202 (21%)
GST_N_Delta_Epsilon 4..77 CDD:239343 17/74 (23%)
GST_C_Delta_Epsilon 91..209 CDD:198287 22/115 (19%)
Gsto2NP_080895.2 GST_N_Omega 6..94 CDD:239353 16/73 (22%)