DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and Gstz1

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001102915.1 Gene:Gstz1 / 681913 RGDID:1589363 Length:216 Species:Rattus norvegicus


Alignment Length:203 Identity:64/203 - (31%)
Similarity:97/203 - (47%) Gaps:13/203 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIV--ARAQLSPEYLEKNPQHTVPTLEDDGHYI 65
            |..||....|.....|::.||...:.||.|.::::  ...|.|.|:...||...||.|:.||..|
  Rat     5 KPVLYSYFRSSCSWRVRIALALKGIDYEIVPINLIKDGGQQFSEEFQTLNPMKQVPALKIDGITI 69

  Fly    66 WDSHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISK-SVLFQ-GQTKVP 128
            ..|.||:.|| .:......|.|:||.|||:|  |:..:   :.|:||:.:.. |||.| ||....
  Rat    70 GQSLAILEYL-EETRPIPRLLPQDPQKRAIV--RMISD---LIASGIQPLQNLSVLKQVGQENQM 128

  Fly   129 KERYDAIIEIYDFVETFLKGQ--DYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKK 191
            .....||...::.:|..|:..  .|..|:::::||..|...||:.|.| .:|.:.||.|....|.
  Rat   129 PWAQKAITSGFNALEKILQSTAGKYCVGDEVSMADVCLAPQVANAERF-KVDLSPYPTISHINKA 192

  Fly   192 LEQLPYYE 199
            |..|..::
  Rat   193 LLALEAFQ 200

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 62/197 (31%)
GST_N_Delta_Epsilon 4..77 CDD:239343 25/74 (34%)
GST_C_Delta_Epsilon 91..209 CDD:198287 34/113 (30%)
Gstz1NP_001102915.1 GST_N_Zeta 6..80 CDD:239340 25/74 (34%)
maiA 7..211 CDD:273527 63/201 (31%)
Glutathione binding. /evidence=ECO:0000250 14..19 1/4 (25%)