DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and GSTT2B

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001074312.1 Gene:GSTT2B / 653689 HGNCID:33437 Length:244 Species:Homo sapiens


Alignment Length:193 Identity:58/193 - (30%)
Similarity:92/193 - (47%) Gaps:16/193 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDSHAIIAYLV 76
            |.|.|||.:......:..|...||:|.....|.|:|:.|....:|||:|....:.:|.||:.||.
Human    11 SQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLS 75

  Fly    77 SKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQ---TKVPKERYD----A 134
            .||...|..||.|...||.|.:.|.:.:..:  .|...|...|...|.   .:||:|:.:    |
Human    76 CKYQTPDHWYPSDLQARARVHEYLGWHADCI--RGTFGIPLWVQVLGPLIGVQVPEEKVERNRTA 138

  Fly   135 IIEIYDFVE-TFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKY---PRIGAWIKKLE 193
            :.:...::| .||..:.::||.|:|:||   :.::..|...|||....:   ||:.||..::|
Human   139 MDQALQWLEDKFLGDRPFLAGQQVTLAD---LMALEELMQPVALGYELFEGRPRLAAWRGRVE 198

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 58/193 (30%)
GST_N_Delta_Epsilon 4..77 CDD:239343 22/64 (34%)
GST_C_Delta_Epsilon 91..209 CDD:198287 30/114 (26%)
GSTT2BNP_001074312.1 GST_N_Theta 3..78 CDD:239348 22/66 (33%)