DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and eef1e1

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001373479.1 Gene:eef1e1 / 565440 ZFINID:ZDB-GENE-030131-4949 Length:173 Species:Danio rerio


Alignment Length:154 Identity:32/154 - (20%)
Similarity:56/154 - (36%) Gaps:29/154 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VPTLEDDGHYIWDSHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSV 119
            ||.|:::..........||..:.|.|....|...|..:||||.|.|....               
Zfish    29 VPVLQNNNGPALTGLVTIACHLVKEAKRPELLGDDAEQRAVVQQWLEHRI--------------- 78

  Fly   120 LFQGQTKVPKERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTK-YP 183
                 ||:.....:.:..|...:..:|:.:.|:|||..|:||..:...:..:...:|:...: |.
Zfish    79 -----TKLDNCSKEEVKVILKDLNRYLEDKVYLAGNVFTLADILMYYGIHHIIVELAIQEKECYL 138

  Fly   184 RIGAWIKKLEQLPYYEEANGKGVR 207
            .:..|...::..|        |:|
Zfish   139 NVSRWFDHIQHYP--------GIR 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 29/141 (21%)
GST_N_Delta_Epsilon 4..77 CDD:239343 5/21 (24%)
GST_C_Delta_Epsilon 91..209 CDD:198287 23/118 (19%)
eef1e1NP_001373479.1 GST_C_AIMP3 64..161 CDD:198338 23/119 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.