DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and gdap1l1

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_687373.1 Gene:gdap1l1 / 562163 ZFINID:ZDB-GENE-080812-2 Length:367 Species:Danio rerio


Alignment Length:273 Identity:48/273 - (17%)
Similarity:88/273 - (32%) Gaps:93/273 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWD 67
            :|.||....|...:.|:|.:....|..|..:|.:....|..|.::..|....||........:.|
Zfish    47 RLVLYHWTQSFSSQKVRLVINEKGLLCEERDVSLPLTEQKEPWFMRLNLGEEVPVFIHGDTIVSD 111

  Fly    68 SHAIIAYL-----------------------VSKYAD---------------------SDALYPK 88
            .:.||.|:                       |.:|.:                     :|::.| 
Zfish   112 YNQIIDYIETNFVGDTVAQLIPDEGTPMYARVQQYRELLDGLPMDAYTHGCILHPELTTDSMIP- 175

  Fly    89 DPLKRAVVDQRLHFESGVVFANGIRSISK---------------------SVLFQGQTKVPKERY 132
               |.|..:.|.|      .||....:.|                     .:|........|:..
Zfish   176 ---KYATAEIRRH------LANAASELMKLDHEEPQLTEPYLSKQKKLMAKILDHDNVNYLKKIL 231

  Fly   133 DAIIEIYDFVETFL-------KGQD---YIAGNQLTIADFSLVSSVASLEAFVALDTTKY----- 182
            ..:..:.|.||..|       :||.   ::.|...|:||..|.:::..|: |:.| :.||     
Zfish   232 GELAMVLDQVEAELEKRKLEYQGQKCELWLCGPTFTLADICLGATLHRLK-FLGL-SRKYWEDGS 294

  Fly   183 -PRIGAWIKKLEQ 194
             |.:.::.:::::
Zfish   295 RPNLQSFFERVQK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 48/272 (18%)
GST_N_Delta_Epsilon 4..77 CDD:239343 18/95 (19%)
GST_C_Delta_Epsilon 91..209 CDD:198287 26/141 (18%)
gdap1l1XP_687373.1 GstA 48..314 CDD:223698 48/272 (18%)
Thioredoxin_like 48..120 CDD:294274 18/71 (25%)
GST_C_GDAP1L1 201..311 CDD:198335 19/109 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589692
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.