Sequence 1: | NP_611328.1 | Gene: | GstE6 / 37111 | FlyBaseID: | FBgn0063494 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001018511.1 | Gene: | gdap1 / 553702 | ZFINID: | ZDB-GENE-050522-424 | Length: | 362 | Species: | Danio rerio |
Alignment Length: | 263 | Identity: | 63/263 - (23%) |
---|---|---|---|
Similarity: | 97/263 - (36%) | Gaps: | 71/263 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KLTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWD 67
Fly 68 SHAIIAYLVSKYADSDA--LYPKDPLK--------RAVVDQR----------LHFESGV-----V 107
Fly 108 FA------------NGIRSIS-----------------KSVLF-QGQTKVPKERYDAIIEIYDFV 142
Fly 143 ETFLK-----------GQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKLEQLP 196
Fly 197 YYE 199 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE6 | NP_611328.1 | GstA | 4..196 | CDD:223698 | 59/257 (23%) |
GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 23/72 (32%) | ||
GST_C_Delta_Epsilon | 91..209 | CDD:198287 | 36/173 (21%) | ||
gdap1 | NP_001018511.1 | GstA | 40..307 | CDD:223698 | 62/262 (24%) |
GST_N_GDAP1 | 40..112 | CDD:239350 | 22/71 (31%) | ||
GST_C_family | 193..304 | CDD:295467 | 29/109 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589746 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |