DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and gdap1

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001018511.1 Gene:gdap1 / 553702 ZFINID:ZDB-GENE-050522-424 Length:362 Species:Danio rerio


Alignment Length:263 Identity:63/263 - (23%)
Similarity:97/263 - (36%) Gaps:71/263 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWD 67
            ||.||....|...:.|:|.:|...|..|..:|.:.......|.::..||...||.|..|.|.|.|
Zfish    39 KLILYHWTQSFSSQKVRLAIAEKGLQCEDYDVSLPLSEHNEPWFMRLNPTGEVPVLVHDNHVICD 103

  Fly    68 SHAIIAYLVSKYADSDA--LYPKDPLK--------RAVVDQR----------LHFESGV-----V 107
            ...|:.||...:.|...  |.|::...        |.::|..          ||.|..|     .
Zfish   104 PTQIMDYLEQNFCDEQTPKLIPEEGSTYYHRVQHYRELLDSLQMDAYTHGCILHPEITVDSHIPA 168

  Fly   108 FA------------NGIRSIS-----------------KSVLF-QGQTKVPKERYDAIIEIYDFV 142
            :|            :.::.::                 ||.|| ....|..|:..|.:..:.|.|
Zfish   169 YATTHIRTQIGNTESELKKLAVENPDLKDAYIAKQRRLKSKLFDHDNMKYLKKLLDELENVLDQV 233

  Fly   143 ETFLK-----------GQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKLEQLP 196
            ||.|:           .|.::.|:..:|||.||..::..|: |:.| :.:|...|..: .||  .
Zfish   234 ETELQRRSEETPEEGSQQAWLCGDFFSIADVSLAVTLHRLK-FLGL-SRRYWGNGMRV-NLE--T 293

  Fly   197 YYE 199
            |||
Zfish   294 YYE 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 59/257 (23%)
GST_N_Delta_Epsilon 4..77 CDD:239343 23/72 (32%)
GST_C_Delta_Epsilon 91..209 CDD:198287 36/173 (21%)
gdap1NP_001018511.1 GstA 40..307 CDD:223698 62/262 (24%)
GST_N_GDAP1 40..112 CDD:239350 22/71 (31%)
GST_C_family 193..304 CDD:295467 29/109 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589746
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.