DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and CLIC6

DIOPT Version :10

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001303938.1 Gene:CLIC6 / 54102 HGNCID:2065 Length:704 Species:Homo sapiens


Alignment Length:122 Identity:23/122 - (18%)
Similarity:52/122 - (42%) Gaps:31/122 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PEYLEKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVF 108
            |.|.:...||  |.....|:.::...:  |::.:...|::.::.|:.||                
Human   554 PRYPKLGTQH--PESNSAGNDVFAKFS--AFIKNTKKDANEIHEKNLLK---------------- 598

  Fly   109 ANGIRSISKSVLFQGQTKVPKERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLV 165
              .:|.:...:    .:.:|.|     |:.|...:..:.|:.::.|::||:||.:|:
Human   599 --ALRKLDNYL----NSPLPDE-----IDAYSTEDVTVSGRKFLDGDELTLADCNLL 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..201 CDD:440390 23/122 (19%)
CLIC6NP_001303938.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..446
PRK07764 <9..382 CDD:236090
13 X 10 AA tandem repeat of G-D-[SNG]-[VIM]-[DEQ]-A-[EAG]-[GDVE]-[PRG]-[LAVP] 157..282
O-ClC 471..704 CDD:129941 23/122 (19%)
G-site. /evidence=ECO:0000250|UniProtKB:Q9Y696 487..490
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.