DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and Gstt3

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_038954940.1 Gene:Gstt3 / 499422 RGDID:1562732 Length:298 Species:Rattus norvegicus


Alignment Length:206 Identity:52/206 - (25%)
Similarity:99/206 - (48%) Gaps:25/206 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGLD-PSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWD 67
            |.|| || .|.|.|||.:......:.::...::::.....:..:.:.||...||.|:|....:.:
  Rat    60 LELY-LDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQHYTDAFAQVNPLRKVPALKDGDFVLAE 123

  Fly    68 SHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQ---GQTKVPK 129
            |.||:.||..||...|..||:|...||.||:.|.::...:.:...|::.:.::|.   || .||.
  Rat   124 SVAILLYLSRKYKAPDHWYPQDLQTRARVDEYLAWQHTALRSCCSRAMWQKMMFPVFLGQ-PVPP 187

  Fly   130 ER-------YDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSV-----ASLEAFVALDTTKY 182
            ||       .|..:::.:  :.||:.:.::.|..:::||...::.:     |..:.|     ...
  Rat   188 ERLASTLAELDGCLQMLE--DKFLQNKAFLTGPHISVADLVAITELMHPVSAGCKIF-----ESR 245

  Fly   183 PRIGAWIKKLE 193
            |::.||.:::|
  Rat   246 PKLAAWRQRVE 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 52/206 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 21/73 (29%)
GST_C_Delta_Epsilon 91..209 CDD:198287 25/118 (21%)
Gstt3XP_038954940.1 GST_N_Theta 60..135 CDD:239348 21/75 (28%)
GST_C_Theta 149..273 CDD:198292 25/116 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348144
Domainoid 1 1.000 62 1.000 Domainoid score I10049
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.650

Return to query results.
Submit another query.