DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and gsto1

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001011256.1 Gene:gsto1 / 496704 XenbaseID:XB-GENE-5771576 Length:241 Species:Xenopus tropicalis


Alignment Length:191 Identity:42/191 - (21%)
Similarity:82/191 - (42%) Gaps:19/191 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PPVRAVKLTLAALNLTYEYVNVDIVARAQLSPE-YLEKNPQHTVPTLE-DDGHYIWDSHAIIAYL 75
            |..:...|.|.|..:.:|.|.::.:.:    |: :.||:|...||.:| ..|..|::|..:..||
 Frog    32 PFAQRAHLILVAKGIKHELVYINTLNK----PDWFFEKSPFGQVPAIETSKGQLIYESQIVCDYL 92

  Fly    76 VSKYADSDALYPKDPLKRAVVDQRL---HFESGVVFANGIRSISKSVLFQGQTKVPKERYDAIIE 137
             .:......|.|:||.::|  .|::   ||......|..|....|:     ...:...:.:.:.:
 Frog    93 -DEVFPGKKLTPQDPFQKA--QQKMLLEHFSKASTVAFKIVGAKKN-----NEDISALKAEFLEK 149

  Fly   138 IYDFVETFLK-GQDYIAGNQLTIADFSLVSSVASLEAFVALD-TTKYPRIGAWIKKLEQLP 196
            :..|.:...| ...|:.|:.:::||:.::......:.|...| ..|.|.:..|.:.:.|.|
 Frog   150 LVQFDQVVAKLNTPYVGGSSVSMADYMILPIFERFDIFGVKDCLEKTPHLLQWYQLMLQDP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 41/189 (22%)
GST_N_Delta_Epsilon 4..77 CDD:239343 18/65 (28%)
GST_C_Delta_Epsilon 91..209 CDD:198287 20/111 (18%)
gsto1NP_001011256.1 GST_N_Omega 6..93 CDD:239353 18/65 (28%)
GST_C_Omega 107..229 CDD:198293 20/111 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16830
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.