DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and GstD6

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster


Alignment Length:198 Identity:73/198 - (36%)
Similarity:123/198 - (62%) Gaps:4/198 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDS 68
            :.||.:..||..|||.:|..|:.:.:..:.|:.....||.|.:::.|||||:|||.|:...||::
  Fly     1 MDLYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWET 65

  Fly    69 HAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQTKVPKERYD 133
            .||:.|||.:|...|:||||||.|:|:::|||:|:.|.:: :||......:|..|:... :|..:
  Fly    66 RAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLY-DGIAKYFFPLLRTGKPGT-QENLE 128

  Fly   134 AIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKLEQL-PY 197
            .:...:|.:..||.||||:|||||::||..::::|::.| .|..|..|:|.:..|.|..::: |.
  Fly   129 KLNAAFDLLNNFLDGQDYVAGNQLSVADIVILATVSTTE-MVDFDLKKFPNVDRWYKNAQKVTPG 192

  Fly   198 YEE 200
            ::|
  Fly   193 WDE 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 71/192 (37%)
GST_N_Delta_Epsilon 4..77 CDD:239343 28/72 (39%)
GST_C_Delta_Epsilon 91..209 CDD:198287 36/111 (32%)
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 28/72 (39%)
PLN02395 11..208 CDD:166036 69/188 (37%)
GST_C_Delta_Epsilon 88..204 CDD:198287 36/111 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460324
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.