DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and GstD4

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster


Alignment Length:200 Identity:76/200 - (38%)
Similarity:120/200 - (60%) Gaps:5/200 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKYA 80
            |.:.:...||.|......:.|.....|.||:|:.|||||:|||.|:|..||:|.||..|||.||.
  Fly    13 RTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWESRAIAVYLVEKYG 77

  Fly    81 DSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQTKVPKERYDAIIEIYDFVETF 145
            ..|:|:|.||.|||:::|||:|:.|.:. :.........:..||.. ..|.|..:...::|::.|
  Fly    78 KDDSLFPNDPQKRALINQRLYFDMGTLH-DSFMKYYYPFIRTGQLG-NAENYKKVEAAFEFLDIF 140

  Fly   146 LKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKLEQL-PYYEEANGKGVRQL 209
            |:||||:||:|||:||.:::|||::.|. |..|.:|||.:..|....::: |.::| |.||:.|:
  Fly   141 LEGQDYVAGSQLTVADIAILSSVSTFEV-VEFDISKYPNVARWYANAKKITPGWDE-NWKGLLQM 203

  Fly   210 VAIFK 214
            ..:::
  Fly   204 KTMYE 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 70/180 (39%)
GST_N_Delta_Epsilon 4..77 CDD:239343 26/60 (43%)
GST_C_Delta_Epsilon 91..209 CDD:198287 41/118 (35%)
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 70/173 (40%)
GST_N_Delta_Epsilon 1..74 CDD:239343 26/60 (43%)
GST_C_Delta_Epsilon 88..204 CDD:198287 42/119 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460311
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.