DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and eEF1gamma

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster


Alignment Length:226 Identity:58/226 - (25%)
Similarity:97/226 - (42%) Gaps:34/226 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKLTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIV-----ARAQLSPEYLEKNPQHTVPTLED 60
            |||.|||....:  .||.|..:||   .|....|.:.     .....|.|:|:|.|...||..|.
  Fly     1 MVKGTLYTYPEN--FRAYKALIAA---QYSGAQVKVADNFKFGETNKSAEFLKKFPGGKVPAFET 60

  Fly    61 -DGHYIWDSHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISK--SVLFQ 122
             :|.|:.:|:| ||||:   |:......|.|..:|.|.|.:.|....:.......:..  .:|.|
  Fly    61 AEGQYLSESNA-IAYLL---ANEQLRGGKCPFVQAQVQQWISFADNEIVPASCAWVFPLLGILPQ 121

  Fly   123 GQTKVPKERYDAIIEIYDFVETFLKGQD--YIAGNQLTIADFSLVSSVASLEAFVALDTTK--YP 183
            .:....|:..:|:::     :...|.||  ::||.::|:||..:.||:..|..:|...:.:  :.
  Fly   122 QKNSTAKQEAEAVLQ-----QLNQKLQDATFLAGERITLADIVVFSSLLHLYEYVLEPSVRSAFG 181

  Fly   184 RIGAWIKKLEQLPYYEEANGKGVRQLVAIFK 214
            .:..|...:        .|.|.|:.:|..:|
  Fly   182 NVNRWFVTI--------LNQKQVQAVVKDYK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 50/203 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 26/78 (33%)
GST_C_Delta_Epsilon 91..209 CDD:198287 24/123 (20%)
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 27/83 (33%)
GstA 5..187 CDD:223698 49/195 (25%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 26/128 (20%)
EF1G 271..376 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459956
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.