DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and gsto1

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001002621.1 Gene:gsto1 / 436894 ZFINID:ZDB-GENE-040718-365 Length:240 Species:Danio rerio


Alignment Length:213 Identity:57/213 - (26%)
Similarity:90/213 - (42%) Gaps:45/213 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPE-YLEKNPQHTVPTLE-DDGHYIW 66
            :.||.:...|..:..:|.|.|..:.|:.:|:::    :..|: :|||||...||.|| ..|..|:
Zfish    23 IRLYSMRFCPFAQRTRLVLNAKGIKYDTININL----KNKPDWFLEKNPLGLVPVLETQSGQVIY 83

  Fly    67 DSHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQT----KV 127
            :|.....||...|.:. .|.|.||.:||  .||:..|                ||...|    |:
Zfish    84 ESPITCEYLDEVYPEK-KLLPFDPFERA--QQRMLLE----------------LFSKVTPYFYKI 129

  Fly   128 PKER-----YDAI-IEIYD----FVETFLKGQD-YIAGNQLTIADFSLVSSVASLEAF---VALD 178
            |..|     ..|: .|:.|    |.|..||.:. :..|:.:|:.|:.:......||..   ..||
Zfish   130 PVNRTKGEDVSALETELKDKLSQFNEILLKKKSKFFGGDSITMIDYMMWPWFERLETMNLKHCLD 194

  Fly   179 TTKYPRIGAWIKKLEQLP 196
            .|  |.:..|.:::.:.|
Zfish   195 GT--PELKKWTERMMEDP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 56/211 (27%)
GST_N_Delta_Epsilon 4..77 CDD:239343 23/74 (31%)
GST_C_Delta_Epsilon 91..209 CDD:198287 29/124 (23%)
gsto1NP_001002621.1 GST_N_Omega 4..93 CDD:239353 22/73 (30%)
GstA 25..210 CDD:223698 56/209 (27%)
GST_C_Omega 107..229 CDD:198293 29/124 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589488
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16830
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.