DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and GstD11

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster


Alignment Length:212 Identity:76/212 - (35%)
Similarity:119/212 - (56%) Gaps:6/212 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDSHA 70
            ||.|.||||.|::.|....|::.:|...|:|:...||.|:::..||||.|||:.|:|..:|:|.|
  Fly    27 LYYLPPSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWESRA 91

  Fly    71 IIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQTKVPKERYDAI 135
            |::|||:.|..||.|||.|...||:|||||.|:.|.::.. :.......:|.| ..:.:.:...:
  Fly    92 ILSYLVAAYGKSDQLYPTDIRVRALVDQRLQFDLGTLYMR-LTDYYFPTMFIG-APLDEGKRAKL 154

  Fly   136 IEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKLE--QLPY- 197
            .|...::.|.|:|:.:.|.:..||||.:|:.:|:.|||| ..:...|..|..|:.:.:  ..|: 
  Fly   155 AEAVGWLNTILEGRQFSAADHFTIADLTLLVTVSQLEAF-EFELRPYKHIRQWLDRCKDHMAPFD 218

  Fly   198 YEEANGKGVRQLVAIFK 214
            |||.|......|..:||
  Fly   219 YEELNANKANMLADMFK 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 68/191 (36%)
GST_N_Delta_Epsilon 4..77 CDD:239343 31/70 (44%)
GST_C_Delta_Epsilon 91..209 CDD:198287 34/120 (28%)
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 31/70 (44%)
GST_C_Delta_Epsilon 112..231 CDD:198287 34/121 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.