DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and GstD1

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster


Alignment Length:212 Identity:82/212 - (38%)
Similarity:126/212 - (59%) Gaps:13/212 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDSHAI 71
            |.|..|.|.|:|.:|..|:.:......:::.|...|.||:|:.|||||:|||.|:|..:|:|.||
  Fly     5 YYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAI 69

  Fly    72 IAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQTKVP--KERYDA 134
            ..|||.||..:|:||||.|.||||::|||:|:.|.::    :|.:.....|...|.|  .|.:..
  Fly    70 QVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLY----QSFANYYYPQVFAKAPADPEAFKK 130

  Fly   135 IIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKLEQL-PYY 198
            |...::|:.|||:||||.||:.||:||.:||::|::.|. ...:.:||..:..|.:..::: |.:
  Fly   131 IEAAFEFLNTFLEGQDYAAGDSLTVADIALVATVSTFEV-AKFEISKYANVNRWYENAKKVTPGW 194

  Fly   199 EEANGKGVRQLVAIFKK 215
            || |..|..:    |||
  Fly   195 EE-NWAGCLE----FKK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 74/191 (39%)
GST_N_Delta_Epsilon 4..77 CDD:239343 29/69 (42%)
GST_C_Delta_Epsilon 91..209 CDD:198287 41/120 (34%)
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 29/69 (42%)
GstA 4..185 CDD:223698 74/184 (40%)
GST_C_Delta_Epsilon 89..205 CDD:198287 41/125 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460246
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.