DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and GstD9

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster


Alignment Length:203 Identity:75/203 - (36%)
Similarity:114/203 - (56%) Gaps:3/203 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDS 68
            |..|.:..|.|.|::.:|..||.|......||:.|...|.||:::.|||||:|||.|||..||:|
  Fly     2 LDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWES 66

  Fly    69 HAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQTKVPKERYD 133
            .||:.||..||....:||||||.:|||::|||.|:...::.:.:......:....:.....:...
  Fly    67 RAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLK 131

  Fly   134 AIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKLEQ-LPY 197
            .|.:.:....|.||||.|.|.|:||:|||:|:::|::.| ....|..|||.:..|....:: :|.
  Fly   132 KIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFE-ISEYDFGKYPEVVRWYDNAKKVIPG 195

  Fly   198 YEEANGKG 205
            :|| |.:|
  Fly   196 WEE-NWEG 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 70/192 (36%)
GST_N_Delta_Epsilon 4..77 CDD:239343 33/72 (46%)
GST_C_Delta_Epsilon 91..209 CDD:198287 34/116 (29%)
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 33/72 (46%)
GstA 4..187 CDD:223698 69/183 (38%)
GST_C_Delta_Epsilon 89..207 CDD:198287 34/116 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460298
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.