DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and GstZ1

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster


Alignment Length:220 Identity:61/220 - (27%)
Similarity:94/220 - (42%) Gaps:46/220 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDI---VARAQLSPEYLEKNPQHTVPTLEDDGHY 64
            |..||...||.....|::.||...:.|:.....:   |:....:.||.|.||...||:|:.|||.
  Fly    33 KPILYSYWPSSCSWRVRVALAIKKIDYDIKPTSLLKTVSGHAYTDEYREVNPMQKVPSLKIDGHT 97

  Fly    65 IWDSHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISK-SVL-------- 120
            :.||.|||.|| .:.....||.|:||:|||.:.:.:.     :..:||:.:.. |||        
  Fly    98 LCDSVAIIHYL-EETRPQPALLPQDPVKRAKIREIVE-----LICSGIQPLQNVSVLDHIGKDQS 156

  Fly   121 -----------FQGQTKVPKERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAF 174
                       |||..||...                ....:..|::|::||..||..|.:...:
  Fly   157 LQWAQHWISRGFQGLEKVLSH----------------SAGKFCVGDELSMADICLVPQVRNARRY 205

  Fly   175 VALDTTKYPRIGAWIKKLEQLPYYE 199
            .| |.|.||.|....::|::|..::
  Fly   206 KA-DLTPYPTIVRLNQELQELDVFK 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 59/214 (28%)
GST_N_Delta_Epsilon 4..77 CDD:239343 27/75 (36%)
GST_C_Delta_Epsilon 91..209 CDD:198287 28/129 (22%)
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 27/75 (36%)
maiA 35..240 CDD:273527 60/218 (28%)
GST_C_Zeta 122..236 CDD:198300 29/130 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460416
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.