DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and gfzf

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster


Alignment Length:215 Identity:81/215 - (37%)
Similarity:123/215 - (57%) Gaps:14/215 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDS 68
            :.||.:...||..||::||.||::.|:.:|||..|....|.||.:.|||..:|.|:|||.|:.:|
  Fly   812 MKLYAVSDGPPSLAVRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGFYLSES 876

  Fly    69 HAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQTKVP---KE 130
            .||:.||..|||....|||:|...|||::|||.|..|..:| .|.:.|.:.:|....:.|   |:
  Fly   877 IAIMQYLCDKYAPDSTLYPQDVNVRAVINQRLCFNMGFYYA-PISAHSMAPIFFDYKRTPMSLKK 940

  Fly   131 RYDAIIEIYDFVETFLK--GQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIK--K 191
            ..:|:    |..||:|:  |..|.||..:|||||:|:|:...||| :..|..::..:..|.:  |
  Fly   941 VQNAL----DVFETYLQRLGTKYAAGENITIADFALISATICLEA-INFDLHQFTLVNKWYETFK 1000

  Fly   192 LEQLPYYEEANGKGVRQLVA 211
            :|....:|.|| .|::::.|
  Fly  1001 VEYPQLWEIAN-SGMQEISA 1019

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 76/198 (38%)
GST_N_Delta_Epsilon 4..77 CDD:239343 32/72 (44%)
GST_C_Delta_Epsilon 91..209 CDD:198287 41/124 (33%)
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 32/73 (44%)
GstA 812..1000 CDD:223698 74/193 (38%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 41/123 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I643
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
87.920

Return to query results.
Submit another query.