DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and clic5b

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_998062.1 Gene:clic5b / 405833 ZFINID:ZDB-GENE-040426-2542 Length:408 Species:Danio rerio


Alignment Length:157 Identity:33/157 - (21%)
Similarity:52/157 - (33%) Gaps:38/157 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PTLEDDGHYIWDSHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGV----------VFAN 110
            |.|..:|....|.:.|..:|....|.     ||.|...|     .|.||..          .|..
Zfish   231 PFLTFNGEVKTDVNKIEEFLEEVLAP-----PKYPKLAA-----RHRESNAAGNDIFAKFSAFIK 285

  Fly   111 GIRSISKSVLFQGQTKVPKERYDAI-------IEIYDFVETFLKGQDYIAGNQLTIADFSLVSSV 168
            ..:..:...|.:|.||..|:..:.:       ::.....|.....:.::.||.||:||.:|:..:
Zfish   286 NTKPDANEALEKGLTKALKKLDEYLNSPLPDEVDADSMEEEKASNRRFLDGNDLTLADCNLLPKL 350

  Fly   169 ASLEAFVALDTTKYPRI-------GAW 188
                ..|.:...||...       |.|
Zfish   351 ----HIVKVVAKKYRNFDIPSDLTGVW 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 33/157 (21%)
GST_N_Delta_Epsilon 4..77 CDD:239343 6/20 (30%)
GST_C_Delta_Epsilon 91..209 CDD:198287 23/122 (19%)
clic5bNP_998062.1 GST_N_CLIC 170..259 CDD:239359 8/32 (25%)
O-ClC 172..407 CDD:129941 33/157 (21%)
GST_C_CLIC5 266..406 CDD:198330 22/112 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589731
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.