DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and gstt1b

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_956878.1 Gene:gstt1b / 393556 ZFINID:ZDB-GENE-040426-1491 Length:242 Species:Danio rerio


Alignment Length:186 Identity:51/186 - (27%)
Similarity:94/186 - (50%) Gaps:11/186 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDSHAIIAYLV 76
            |.|.|:|.:.....|:.::|..:.:....|...|:.:.||....||::|....:.:|.||:.||.
Zfish    11 SQPCRSVYIFAKKNNIQFDYKKISLFEGYQYGEEFGKINPLRKFPTIKDGDFCLAESVAIMIYLA 75

  Fly    77 SKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQG--QTKVPKERYDAI---- 135
            .|:...|..:|.|..|||.|::.|.::...:..:|.:.|...:|...  ..:||||:.:..    
Zfish    76 DKFHTPDHWFPADLQKRARVNEYLSWQHTSIRMHGAKIIWFKILIPEVLGAEVPKEKMENAEENL 140

  Fly   136 -IEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVA-LDT-TKYPRIGAW 188
             :.:..|.:.||:.:.:|.|:|:::||  ||:.|..::.|.| :|. ...|::.||
Zfish   141 NVALQLFQDKFLQDKPFIVGDQISLAD--LVAIVEIMQPFAAGMDVFENRPKLKAW 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 51/186 (27%)
GST_N_Delta_Epsilon 4..77 CDD:239343 18/64 (28%)
GST_C_Delta_Epsilon 91..209 CDD:198287 29/107 (27%)
gstt1bNP_956878.1 GstA 1..199 CDD:223698 51/186 (27%)
GST_N_Theta 3..78 CDD:239348 18/66 (27%)
GST_C_Theta 91..217 CDD:198292 29/106 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10727
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.