DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and GstO1

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster


Alignment Length:210 Identity:52/210 - (24%)
Similarity:77/210 - (36%) Gaps:59/210 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGLDPSPPVRAVKLTLAALNLTYE--YVNVDIVARAQLSPEYLEKNPQHT-VPTLE---DDG 62
            |.||.:...|....|.|.|.|..:.|.  |:|:      :..||:.......| ||.||   :.|
  Fly    22 LKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINL------RDKPEWFSLVSSSTKVPALELVKEQG 80

  Fly    63 H-YIWDSHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQTK 126
            : .:.:|..|..||..||.:. .|||||.||:|                             |.|
  Fly    81 NPVLIESLIICDYLDEKYPEV-PLYPKDLLKKA-----------------------------QEK 115

  Fly   127 VPKERYDAIIE------IYDFVETFLKGQDYIAGNQLTIADFSLVSSVASL---EAFVALDTTKY 182
            :..||:...|.      ::|..|. |...|:.||  |.:.:..|.......   ::...||...:
  Fly   116 ILIERFGQFINAFYYLLLHDNPEQ-LVDTDHYAG--LVVYEEELKRRCTKFFGGDSPGMLDYMMW 177

  Fly   183 PRIGAWIKKLEQLPY 197
            |    |.::.:.|.|
  Fly   178 P----WCERFDSLKY 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 50/207 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 23/79 (29%)
GST_C_Delta_Epsilon 91..209 CDD:198287 22/116 (19%)
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 22/78 (28%)
GstA 22..216 CDD:223698 52/210 (25%)
GST_C_Omega 109..234 CDD:198293 22/116 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460195
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.