DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and GstO2

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster


Alignment Length:220 Identity:55/220 - (25%)
Similarity:101/220 - (45%) Gaps:42/220 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VKLTLAALNLTYEYVNVDIVARAQLSPE-YLEKNPQHTVPTLEDDGHYIWDSHAII-AYLVSKYA 80
            |:|.|||.::.:..:.||::.:    || |.:.:|...||.|:..|  :.|...:: :.::::|.
  Fly    37 VRLMLAAKHIEHHKIYVDLIEK----PEWYKDFSPLGKVPALQLTG--VKDQPTLVESLIIAEYL 95

  Fly    81 DSD----ALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQTKVPKERYDAI------ 135
            |..    .|:|.|||::|:  .::..|.   ||..:     |.::...|..|....|||      
  Fly    96 DQQYPQTRLFPTDPLQKAL--DKILIER---FAPVV-----SAIYPVLTCNPNAPKDAIPNFENA 150

  Fly   136 IEIYDFVETFLKGQDYIAGNQLTIADFSL-------VSSVASLEAFVALDTTKYPRIGAWIKKLE 193
            ::::: ||...:|..|.||..:.|.|:.:       .|...:.|....|||.::.::..|...:.
  Fly   151 LDVFE-VELGKRGTPYFAGQHIGIVDYMIWPWFERFPSMKINTEQKYELDTKRFEKLLKWRDLMT 214

  Fly   194 QLPYYEEANGKGVR--QLVAIFKKT 216
            |    :|...|...  ||.|.|:|:
  Fly   215 Q----DEVVQKTALDVQLHAEFQKS 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 48/196 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 16/60 (27%)
GST_C_Delta_Epsilon 91..209 CDD:198287 28/132 (21%)
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 17/64 (27%)
GstA 25..215 CDD:223698 47/194 (24%)
GST_C_Omega 110..235 CDD:198293 32/139 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460208
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16830
SonicParanoid 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.