DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and GstO3

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster


Alignment Length:205 Identity:57/205 - (27%)
Similarity:93/205 - (45%) Gaps:33/205 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYL-EKNPQHTVPTLE---DDGH- 63
            |.||.:...|..:...|.|.|.|:.|..|.:::..:    ||:| |.:|...||.|:   :.|. 
  Fly    22 LRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTEK----PEWLVEVSPLLKVPALQLVAEKGEP 82

  Fly    64 YIWDSHAIIAYLVSKYADSDALYPKDPLKRA---VVDQRLHFESGVVFANGIRSISKSVLFQGQT 125
            .:.:|..|..||..||.: :.|.||||||||   ::.:|.         :.|.|...::|.||  
  Fly    83 SLIESLIIAEYLDDKYPE-NPLLPKDPLKRAQDKILLERF---------SSITSAFINILVQG-- 135

  Fly   126 KVPKERYDAIIEIYDFVETFLKGQDYIAGNQLTIAD------FSLVSSV-ASLEAFVALDTTKYP 183
             ...|.|...::|:: .|...:|..|..||:....|      |..:|.: ..|:.....:.:::|
  Fly   136 -TGLEDYWTALDIFE-EELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYNFNESRFP 198

  Fly   184 RIGAWIKKLE 193
            :|..||..|:
  Fly   199 KITKWIALLK 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 57/205 (28%)
GST_N_Delta_Epsilon 4..77 CDD:239343 23/77 (30%)
GST_C_Delta_Epsilon 91..209 CDD:198287 27/113 (24%)
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 22/76 (29%)
GstA 22..209 CDD:223698 57/205 (28%)
GST_C_Omega 109..230 CDD:198293 27/113 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460182
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16830
SonicParanoid 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.