DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and Gr59f

DIOPT Version :10

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster


Alignment Length:45 Identity:11/45 - (24%)
Similarity:20/45 - (44%) Gaps:5/45 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 IWDSHAIIAYLVSK--YADSDALYPKDPLKRAVVDQRLHFESGVV 107
            |.:.|:....|:|:  ||..|.   :|.:...::..|.:....||
  Fly   318 IQNEHSTCLTLLSRVSYARKDI---QDTITHFIIQMRTNVRQHVV 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..201 CDD:440390 11/45 (24%)
Gr59fNP_788432.1 7tm_7 61..388 CDD:473258 11/45 (24%)

Return to query results.
Submit another query.