DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and GstE11

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster


Alignment Length:214 Identity:91/214 - (42%)
Similarity:136/214 - (63%) Gaps:3/214 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWD 67
            |..||....|||.|||.||.|||.|..:...|::.|....|.|:|:.|.|||:|.|:|:|..:.|
  Fly     4 KPILYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSD 68

  Fly    68 SHAIIAYLVSKYA--DSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQTKVPKE 130
            ||.|.:||..|||  ..|:||||||.||.:||.||:::.|.:|.. ||.|.:.|::.|..:||.:
  Fly    69 SHIICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPR-IRFIVEPVIYFGAGEVPSD 132

  Fly   131 RYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKLEQL 195
            |...:.:.||.:|..|...||:.|::|||||.|.::||::.|||..::..::||:..|:|:::.|
  Fly   133 RVAYLQKAYDGLEHCLAEGDYLVGDKLTIADLSCIASVSTAEAFAPIEPDQFPRLVQWVKRIQAL 197

  Fly   196 PYYEEANGKGVRQLVAIFK 214
            |||::.|.:|:..||.:.|
  Fly   198 PYYQKNNQEGLDMLVGLVK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 81/193 (42%)
GST_N_Delta_Epsilon 4..77 CDD:239343 33/72 (46%)
GST_C_Delta_Epsilon 91..209 CDD:198287 44/117 (38%)
GstE11NP_001286575.1 GstA 5..198 CDD:223698 81/193 (42%)
GST_N_Delta_Epsilon 5..78 CDD:239343 33/72 (46%)
GST_C_Delta_Epsilon 94..211 CDD:198287 44/117 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468027
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.