DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and GstE4

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster


Alignment Length:219 Identity:123/219 - (56%)
Similarity:167/219 - (76%) Gaps:0/219 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKLTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYI 65
            |.|::|||||.|||.||..|||.||:|.:|:|.|::..:...|.::.:||||||||.|:||...|
  Fly     1 MGKISLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACI 65

  Fly    66 WDSHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQTKVPKE 130
            ||||||:||||.|||.||.|||||.|:||.|||.:||||||:|.:.:|.:::.|||.|:..:|:.
  Fly    66 WDSHAIMAYLVEKYAPSDELYPKDLLQRAKVDQLMHFESGVIFESALRRLTRPVLFFGEPTLPRN 130

  Fly   131 RYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKLEQL 195
            :.|.|:::||||||||...|::||:||||||||:||::.|:..|:.||..|||:|.||:::|::|
  Fly   131 QVDHILQVYDFVETFLDDHDFVAGDQLTIADFSIVSTITSIGVFLELDPAKYPKIAAWLERLKEL 195

  Fly   196 PYYEEANGKGVRQLVAIFKKTNFT 219
            ||||||||||..|.|.:.:..|||
  Fly   196 PYYEEANGKGAAQFVELLRSKNFT 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 105/191 (55%)
GST_N_Delta_Epsilon 4..77 CDD:239343 41/72 (57%)
GST_C_Delta_Epsilon 91..209 CDD:198287 64/117 (55%)
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 41/72 (57%)
GstA 6..196 CDD:223698 105/189 (56%)
GST_C_Delta_Epsilon 91..209 CDD:198287 64/117 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467960
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 1 1.000 - - H120001
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1211.800

Return to query results.
Submit another query.