DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and GstE14

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster


Alignment Length:208 Identity:67/208 - (32%)
Similarity:115/208 - (55%) Gaps:5/208 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWD 67
            |..||..:.|||||:..:.:..|::..|...|::....|...::|..||||:||||......:.|
  Fly     5 KPILYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTD 69

  Fly    68 SHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQTKVPKERY 132
            ||||:.:|..|:.:..:|:|::..:|..|...|.||...:|......:|.:|. ||...|....:
  Fly    70 SHAILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVR-QGFANVDVAHH 133

  Fly   133 D-AIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKLEQLP 196
            : .:.|.|..:|.:|:..|::||.|||:||.|:|::::::.....|  :::||:..|...::||.
  Fly   134 ERKLTEAYIIMERYLENSDFMAGPQLTLADLSIVTTLSTVNLMFPL--SQFPRLRRWFTAMQQLD 196

  Fly   197 YYEEANGKGVRQL 209
            .| |||..|:.:|
  Fly   197 AY-EANCSGLEKL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 59/192 (31%)
GST_N_Delta_Epsilon 4..77 CDD:239343 26/72 (36%)
GST_C_Delta_Epsilon 91..209 CDD:198287 36/118 (31%)
GstE14NP_610855.1 GstA 6..200 CDD:223698 61/197 (31%)
GST_N_Delta_Epsilon 6..79 CDD:239343 26/72 (36%)
GST_C_Delta_Epsilon 94..209 CDD:198287 37/119 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16830
SonicParanoid 1 1.000 - - X30
1010.000

Return to query results.
Submit another query.