DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and GstT4

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster


Alignment Length:222 Identity:45/222 - (20%)
Similarity:99/222 - (44%) Gaps:32/222 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEK-NPQHTVPTLEDDGHYIWDSHAIIAYLVSKY 79
            ||:.:.|.|..:.:|.:.:.::....|:.|:.:. |....:|.:.|.|:.:.::.||..:|..:.
  Fly    17 RALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSENVAIFRHLAREK 81

  Fly    80 ADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQTKVP---KER-YDAIIE--- 137
            ...:..||:..|.|:.:|:.|.::...:      .::.:..||.:..||   |.| .|..:.   
  Fly    82 LVPEHWYPRRHLGRSRIDEYLAWQQTNM------GVATTEYFQQKWLVPYLQKTRPADNAVNLAS 140

  Fly   138 ------IYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKL-EQL 195
                  :.:|.:.||..:.::.|:.::.||.|.:..:...::..........::..|.:.: |:|
  Fly   141 KQLEHTLNEFEQLFLNSRKFMMGDNISYADLSAICEIDQPKSIGYNAFQNRNKLARWYETVREEL 205

  Fly   196 -PYYEE----------ANGKGVRQLVA 211
             |:|:|          .:|.|.:|.||
  Fly   206 GPHYKEVLGEFEAKLKGSGSGQQQGVA 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 37/195 (19%)
GST_N_Delta_Epsilon 4..77 CDD:239343 14/61 (23%)
GST_C_Delta_Epsilon 91..209 CDD:198287 26/142 (18%)
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 14/62 (23%)
GST_C_Theta 95..220 CDD:198292 23/130 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459990
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.