DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and Gdap1l1

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_038961050.1 Gene:Gdap1l1 / 311616 RGDID:1304960 Length:369 Species:Rattus norvegicus


Alignment Length:254 Identity:47/254 - (18%)
Similarity:86/254 - (33%) Gaps:85/254 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDSHAIIAYL------- 75
            |:|.:|...|:.|..:|.:.......|.::..|....||.:....:.|.|...||.|:       
  Rat    64 VRLVIAEKGLSCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFTGE 128

  Fly    76 ----------------------------VSKYADSDALYPK---DPL--KRAVVDQRLHFESGVV 107
                                        :..|.....|:|:   |.:  |.|..:.|.|      
  Rat   129 HVVALMPEAGSPQHARVLQYRELLDALPMDAYTHGCILHPELTTDSMIPKYATAEIRRH------ 187

  Fly   108 FANGIRSISKSVLFQGQTKVP-----KERYDAIIE----------------IYDFVETFL----- 146
            .||....:.|....:.|...|     |:....|:|                :.|.:|..|     
  Rat   188 LANATTDLMKLDHEEPQLSEPYLSKQKKLMAKILEHDDVGYLKKILGELAMVLDQIEAELEKRKL 252

  Fly   147 --KGQD---YIAGNQLTIADFSLVSSVASLEAFVALDTTKY------PRIGAWIKKLEQ 194
              :||.   ::.|...|:||..|.:::..|: |:.| :.||      |.:.::.:::::
  Rat   253 ENEGQTCELWLCGCAFTLADVLLGATLHRLK-FLGL-SKKYWEDGSRPNLQSFFERVQR 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 47/254 (19%)
GST_N_Delta_Epsilon 4..77 CDD:239343 15/93 (16%)
GST_C_Delta_Epsilon 91..209 CDD:198287 28/143 (20%)
Gdap1l1XP_038961050.1 Thioredoxin_like 47..122 CDD:412351 15/57 (26%)
GST_C_family 203..313 CDD:413470 21/109 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348279
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.