DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment GstE6 and Clic6

DIOPT Version :9

Sequence 1:	NP_611328.1	Gene:	GstE6 / 37111	FlyBaseID:	FBgn0063494	Length:	222	Species:	Drosophila melanogaster
Sequence 2:	NP_788267.2	Gene:	Clic6 / 304081	RGDID:	727938	Length:	613	Species:	Rattus norvegicus

Alignment Length:	143	Identity:	28/143 - (19%)
Similarity:	59/143 - (41%)	Gaps:	40/143 - (27%)

- Green bases have known domain annotations that are detailed below.

  Fly    25 LNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKYADSDALYPKD 89
            :|...|::...:|     .|.|.:...||  |.....|:.::...:  |::.:...|::.:|.|
  Rat   449 VNKIEEFLEEKLV-----PPRYPKLGTQH--PESNSAGNDVFAKFS--AFIKNTKKDANDIYEK- 503

  Fly    90 PLKRAVVDQRLHFESGVVFANGIRSISK--SVLFQGQTKVPKERYDAIIEIYDFVETFLKGQDYI 152
                                |.:|::.|  |.|   .:.:|.|     |:.|...:..:..:.::
  Rat   504 --------------------NLLRALKKLDSYL---NSPLPDE-----IDAYSTEDVTVSQRKFL 540

  Fly   153 AGNQLTIADFSLV 165
            .|::||:||.:|:
  Rat   541 DGDELTLADCNLL 553

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
GstE6	NP_611328.1	GstA	4..196	CDD:223698	28/143 (20%)
		GST_N_Delta_Epsilon	4..77	CDD:239343	10/51 (20%)
		GST_C_Delta_Epsilon	91..209	CDD:198287	15/77 (19%)
Clic6	NP_788267.2	2A1904	<51..318	CDD:273344
Clic6	NP_788267.2	O-ClC	380..613	CDD:129941	28/143 (20%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C166348031
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930