DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and Clic4

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_038913.1 Gene:Clic4 / 29876 MGIID:1352754 Length:253 Species:Mus musculus


Alignment Length:184 Identity:33/184 - (17%)
Similarity:66/184 - (35%) Gaps:62/184 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PEYLEKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKYADSDALYPKDPLKR-AVVDQRLHFESGVV 107
            |:||:.:|:|  |.....|..|:...:  ||:.:...:::....:..||. ..:|:.|:      
Mouse   102 PKYLKLSPKH--PESNTAGMDIFAKFS--AYIKNSRPEANEALERGLLKTLQKLDEYLN------ 156

  Fly   108 FANGIRSISKSVLFQGQTKVPKERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLE 172
                             :.:|.|..:..:|...|     ..:.::.|:::|:||.:|:..:    
Mouse   157 -----------------SPLPDEIDENSMEDIKF-----STRRFLDGDEMTLADCNLLPKL---- 195

  Fly   173 AFVALDTTKY-----PR--IGAWIKKLEQLPYYEEANGKGVRQLVAIFKKTNFT 219
            ..|.:...||     |:  .|.|                  |.|...:.:..||
Mouse   196 HIVKVVAKKYRNFDIPKGMTGIW------------------RYLTNAYSRDEFT 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 29/159 (18%)
GST_N_Delta_Epsilon 4..77 CDD:239343 10/32 (31%)
GST_C_Delta_Epsilon 91..209 CDD:198287 20/125 (16%)
Clic4NP_038913.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..101
O-ClC 17..252 CDD:129941 33/184 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844484
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.