DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and Clic3

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001013098.2 Gene:Clic3 / 296566 RGDID:1307249 Length:237 Species:Rattus norvegicus


Alignment Length:136 Identity:28/136 - (20%)
Similarity:52/136 - (38%) Gaps:42/136 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LSPEYLEKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKY-ADSDALYPKDPLKRAVVDQRLHFESG 105
            |:|.|.|.|..         |:.|:  |...|::.:.. ...||||           |:|     
  Rat    95 LAPRYRESNTA---------GNDIF--HKFSAFIKNPVPTQDDALY-----------QQL----- 132

  Fly   106 VVFANGIRSISKSVLFQGQTKVPKERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVAS 170
                  :|::::...:.|   .|.:.     |:..........:.::.|:|||:||.||:..:..
  Rat   133 ------LRALTRLDRYLG---TPLDH-----ELAQEPHLSESRRRFLDGDQLTLADCSLLPKLHI 183

  Fly   171 LEAFVA 176
            ::...|
  Rat   184 VDTVCA 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 28/136 (21%)
GST_N_Delta_Epsilon 4..77 CDD:239343 9/34 (26%)
GST_C_Delta_Epsilon 91..209 CDD:198287 15/86 (17%)
Clic3NP_001013098.2 O-ClC 6..230 CDD:129941 28/136 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348177
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.