DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and GSTZ1

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001350632.1 Gene:GSTZ1 / 2954 HGNCID:4643 Length:217 Species:Homo sapiens


Alignment Length:188 Identity:63/188 - (33%)
Similarity:97/188 - (51%) Gaps:13/188 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VKLTLAALNLTYEYVNVDIV--ARAQLSPEYLEKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKYA 80
            |::.||...:.||.|.::::  ...|.|.::...||...||||:.||..|..|.|||.|| .:..
Human    21 VRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYL-EEMR 84

  Fly    81 DSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISK-SVLFQ-GQTKVPKERYDAIIEIYDFVE 143
            .:..|.|:||.|||.|  |:..:   :.|.||:.:.. |||.| |:........:||...::.:|
Human    85 PTPRLLPQDPKKRASV--RMISD---LIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALE 144

  Fly   144 TFLKGQD--YIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKLEQLPYYE 199
            ..|:...  |..|:::|:||..||..||:.|.| .:|.|.||.|.:..|:|..|..::
Human   145 QILQSTAGIYCVGDEVTMADLCLVPQVANAERF-KVDLTPYPTISSINKRLLVLEAFQ 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 62/183 (34%)
GST_N_Delta_Epsilon 4..77 CDD:239343 23/60 (38%)
GST_C_Delta_Epsilon 91..209 CDD:198287 36/113 (32%)
GSTZ1NP_001350632.1 maiA 8..212 CDD:273527 63/188 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.