DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and GSTT1

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_000844.2 Gene:GSTT1 / 2952 HGNCID:4641 Length:240 Species:Homo sapiens


Alignment Length:205 Identity:53/205 - (25%)
Similarity:98/205 - (47%) Gaps:23/205 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGLD-PSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWD 67
            |.|| || .|.|.|||.:.....::.:|...||::....||..:.:.||...||.|:|....:.:
Human     3 LELY-LDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTE 66

  Fly    68 SHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQ---GQTKVPK 129
            |.||:.||..||...|..||:|...||.||:.|.::...:..:.:|::...|:|.   |:...|:
Human    67 SVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQ 131

  Fly   130 ------ERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSV-----ASLEAFVALDTTKYP 183
                  ...|..:::.:  :.||:.:.::.|..:::||...::.:     |..:.|..     .|
Human   132 TLAATLAELDVTLQLLE--DKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEG-----RP 189

  Fly   184 RIGAWIKKLE 193
            ::..|.:::|
Human   190 KLATWRQRVE 199

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 53/205 (26%)
GST_N_Delta_Epsilon 4..77 CDD:239343 26/73 (36%)
GST_C_Delta_Epsilon 91..209 CDD:198287 21/117 (18%)
GSTT1NP_000844.2 GST_N_Theta 3..78 CDD:239348 26/75 (35%)