DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and GSTA2

DIOPT Version :10

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_000837.3 Gene:GSTA2 / 2939 HGNCID:4627 Length:222 Species:Homo sapiens


Alignment Length:200 Identity:54/200 - (27%)
Similarity:89/200 - (44%) Gaps:41/200 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEK--NPQH----TVPTLEDDGHYIWDSHAIIA 73
            :.:::..|||..:.:|...:.       |.|.|:|  |..:    .||.:|.||..:..:.||:.
Human    16 MESIRWLLAAAGVEFEEKFIK-------SAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILN 73

  Fly    74 YLVSKYADSDALYPKDPLKRAVVDQRLHFESGVV----------FANGIRSISKSVLFQGQTKVP 128
            |:.|||    .||.||..::|::|.   :..|:.          |:......:|..|.|.:|   
Human    74 YIASKY----NLYGKDIKEKALIDM---YIEGIADLGEMILLLPFSQPEEQDAKLALIQEKT--- 128

  Fly   129 KERYDAIIEIYDFVETFLK--GQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKK 191
            |.||      :...|..||  ||||:.||:|:.||..||..:..:|...:...:.:|.:.|...:
Human   129 KNRY------FPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTR 187

  Fly   192 LEQLP 196
            :..||
Human   188 ISNLP 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..201 CDD:440390 53/199 (27%)
GSTA2NP_000837.3 GST_N_Alpha 4..82 CDD:239375 20/76 (26%)
GST_C_Alpha 86..220 CDD:198317 29/118 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 199..222
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.