DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and Eef1g

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001004223.1 Gene:Eef1g / 293725 RGDID:1302939 Length:437 Species:Rattus norvegicus


Alignment Length:220 Identity:54/220 - (24%)
Similarity:87/220 - (39%) Gaps:58/220 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RAVKLTLAALNLTYEYVNVDIVA--------RAQLSPEYLEKNPQHTVPTLE-DDGHYIWDSHAI 71
            ||.|..:||   .|....:.:::        :...:||:|.|.|...||..| |||..:::|:| 
  Rat    14 RAFKALIAA---QYSGAQIRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNA- 74

  Fly    72 IAYLVS-------------------KYADSDALYPKDPLKRAVVDQRLHFESGVVFAN-GIRSIS 116
            |||.||                   .:||||.:.|               .|..||.. ||...:
  Rat    75 IAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPP---------------ASTWVFPTLGIMHHN 124

  Fly   117 KSVLFQGQTKVPKERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTK 181
            |..     |:..||....|:.:.|   |.||.:.::.|.::|:||.::|.::..|...|...:.:
  Rat   125 KQA-----TENAKEEVKRILGLLD---THLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFR 181

  Fly   182 --YPRIGAWIKKLEQLPYYEEANGK 204
              :|....|.......|.:....|:
  Rat   182 QAFPNTNRWFLTCINQPQFRAILGE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 52/210 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 22/69 (32%)
GST_C_Delta_Epsilon 91..209 CDD:198287 25/117 (21%)
Eef1gNP_001004223.1 GST_N_EF1Bgamma 4..82 CDD:239342 24/71 (34%)
maiA 5..187 CDD:273527 51/199 (26%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 30/139 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..268
EF1G 275..381 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.