DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and CLIC4

DIOPT Version :10

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_039234.1 Gene:CLIC4 / 25932 HGNCID:13518 Length:253 Species:Homo sapiens


Alignment Length:184 Identity:34/184 - (18%)
Similarity:66/184 - (35%) Gaps:62/184 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PEYLEKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKYADSDALYPKDPLKR-AVVDQRLHFESGVV 107
            |:||:.:|:|  |.....|..|:...:  ||:.:...:::....:..||. ..:|:.|:      
Human   102 PKYLKLSPKH--PESNTAGMDIFAKFS--AYIKNSRPEANEALERGLLKTLQKLDEYLN------ 156

  Fly   108 FANGIRSISKSVLFQGQTKVPKERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLE 172
                             :.:|.|..:..:|...|     ..:.::.||::|:||.:|:..:    
Human   157 -----------------SPLPDEIDENSMEDIKF-----STRKFLDGNEMTLADCNLLPKL---- 195

  Fly   173 AFVALDTTKY-----PR--IGAWIKKLEQLPYYEEANGKGVRQLVAIFKKTNFT 219
            ..|.:...||     |:  .|.|                  |.|...:.:..||
Human   196 HIVKVVAKKYRNFDIPKEMTGIW------------------RYLTNAYSRDEFT 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..201 CDD:440390 30/164 (18%)
CLIC4NP_039234.1 Required for insertion into the membrane. /evidence=ECO:0000305 2..101
O-ClC 17..252 CDD:129941 34/184 (18%)
G-site. /evidence=ECO:0000250|UniProtKB:Q9Z0W7 35..38
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.