DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and gst1

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_588298.1 Gene:gst1 / 2538694 PomBaseID:SPCC191.09c Length:229 Species:Schizosaccharomyces pombe


Alignment Length:222 Identity:69/222 - (31%)
Similarity:103/222 - (46%) Gaps:34/222 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKLTL----YGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLED- 60
            |.:.||    :|.:|...|:|:|    .|:||||...|:.....|.|||:|..||...||||.| 
pombe     1 MAQFTLWSHAHGPNPWKVVQALK----ELDLTYETRYVNFSKNEQKSPEHLALNPNGRVPTLIDH 61

  Fly    61 --DGHYIWDSHAIIAYLVSKY-ADSDALYPKDPLKRAVVDQRLHFES---GVVF--ANGIRSISK 117
              :.:.||:|.||:.||..|| .:.....|:|..:...|.|.|.|::   |:::  |.......:
pombe    62 HNNDYTIWESDAILIYLADKYDTERKISLPRDHPEYYKVIQYLFFQASGQGIIWGQAGWFSVYHQ 126

  Fly   118 SVLFQGQTKVPKERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVA------ 176
            .::....|:...|    |..:...:|..||.:||:..|:.||||.|.:|....||...|      
pombe   127 ELVISAITRYRNE----IKRVLGVLEDILKDRDYLVANRFTIADLSFISWNNFLEIIFAEGKFSI 187

  Fly   177 ------LDTTK-YPRIGAWIKKLEQLP 196
                  ||..| :||..:|.::|...|
pombe   188 EEEVPQLDFEKEFPRTYSWHQRLLARP 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 67/217 (31%)
GST_N_Delta_Epsilon 4..77 CDD:239343 32/79 (41%)
GST_C_Delta_Epsilon 91..209 CDD:198287 32/124 (26%)
gst1NP_588298.1 GST_N_Ure2p_like 3..84 CDD:239346 34/84 (40%)
GstA 5..218 CDD:223698 68/218 (31%)
GST_C_Ure2p 96..219 CDD:198326 32/123 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1854
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm9258
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16830
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
98.790

Return to query results.
Submit another query.