DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and Gstt1

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_445745.1 Gene:Gstt1 / 25260 RGDID:2765 Length:240 Species:Rattus norvegicus


Alignment Length:201 Identity:55/201 - (27%)
Similarity:98/201 - (48%) Gaps:15/201 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGLD-PSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWD 67
            |.|| || .|.|.||:.:.....|:.::...|::.....||..:.:.||...||.::|.|..:.:
  Rat     3 LELY-LDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFAQVNPMKKVPAMKDGGFTLCE 66

  Fly    68 SHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQ---GQTKVPK 129
            |.||:.||..||...|..||:|...||.||:.|.::...:..:.:|::...|:|.   |:...|:
  Rat    67 SVAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRSCLRTLWHKVMFPVFLGEQIRPE 131

  Fly   130 ----ERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKY---PRIGA 187
                ...|..:.:....:.||:.:|::.|..:::||   |.::..|...|......:   ||:.|
  Rat   132 MLAATLADLDVNVQVLEDQFLQDKDFLVGPHISLAD---VVAITELMHPVGGGCPVFEGRPRLAA 193

  Fly   188 WIKKLE 193
            |.:::|
  Rat   194 WYRRVE 199

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 55/201 (27%)
GST_N_Delta_Epsilon 4..77 CDD:239343 24/73 (33%)
GST_C_Delta_Epsilon 91..209 CDD:198287 25/113 (22%)
Gstt1NP_445745.1 GST_N_Theta 3..78 CDD:239348 24/75 (32%)