Sequence 1: | NP_611328.1 | Gene: | GstE6 / 37111 | FlyBaseID: | FBgn0063494 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_659140.2 | Gene: | Gdap1l1 / 228858 | MGIID: | 2385163 | Length: | 367 | Species: | Mus musculus |
Alignment Length: | 263 | Identity: | 45/263 - (17%) |
---|---|---|---|
Similarity: | 88/263 - (33%) | Gaps: | 74/263 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 LTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDS 68
Fly 69 HAIIAYL-----------------------------------VSKYADSDALYPK---DPL--KR 93
Fly 94 AVVDQRLHFESGVV----------------FANGIRSISKSVLFQGQTKVPKERYDAIIEIYDFV 142
Fly 143 ETFL-------KGQD---YIAGNQLTIADFSLVSSVASLEAFVALDTTKY------PRIGAWIKK 191
Fly 192 LEQ 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE6 | NP_611328.1 | GstA | 4..196 | CDD:223698 | 45/263 (17%) |
GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 19/107 (18%) | ||
GST_C_Delta_Epsilon | 91..209 | CDD:198287 | 22/138 (16%) | ||
Gdap1l1 | NP_659140.2 | GstA | 47..314 | CDD:223698 | 45/263 (17%) |
GST_N_GDAP1 | 47..119 | CDD:239350 | 19/71 (27%) | ||
GST_C_family | 201..311 | CDD:295467 | 18/109 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167844813 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |