DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and Gdap1l1

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_659140.2 Gene:Gdap1l1 / 228858 MGIID:2385163 Length:367 Species:Mus musculus


Alignment Length:263 Identity:45/263 - (17%)
Similarity:88/263 - (33%) Gaps:74/263 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDS 68
            |.||....|...:.|:|.:|...|..|..:|.:.......|.::..|....||.:....:.|.|.
Mouse    47 LVLYHWTQSFSSQKVRLVIAEKGLACEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDY 111

  Fly    69 HAIIAYL-----------------------------------VSKYADSDALYPK---DPL--KR 93
            ..||.|:                                   :..|.....|:|:   |.:  |.
Mouse   112 DQIIDYVERTFTGEHVVALMPEAGSPQHARVLQYRELLDALPMDAYTHGCILHPELTTDSMIPKY 176

  Fly    94 AVVDQRLHFESGVV----------------FANGIRSISKSVLFQGQTKVPKERYDAIIEIYDFV 142
            |..:.|.|..:...                :.:..:.:...:|........|:....:..:.|.:
Mouse   177 ATAEIRRHLANATTDLMKLDHEEEPQLSEPYLSKQKKLMAKILEHDDVSYLKKILGELAMVLDQI 241

  Fly   143 ETFL-------KGQD---YIAGNQLTIADFSLVSSVASLEAFVALDTTKY------PRIGAWIKK 191
            |..|       :||.   ::.|...|:||..|.:::..|: |:.| :.||      |.:.::.::
Mouse   242 EAELEKRKLENEGQTCELWLCGCAFTLADVLLGATLHRLK-FLGL-SKKYWEDGSRPNLQSFFER 304

  Fly   192 LEQ 194
            :::
Mouse   305 VQR 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 45/263 (17%)
GST_N_Delta_Epsilon 4..77 CDD:239343 19/107 (18%)
GST_C_Delta_Epsilon 91..209 CDD:198287 22/138 (16%)
Gdap1l1NP_659140.2 GstA 47..314 CDD:223698 45/263 (17%)
GST_N_GDAP1 47..119 CDD:239350 19/71 (27%)
GST_C_family 201..311 CDD:295467 18/109 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844813
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.