DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and gst-43

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_491070.1 Gene:gst-43 / 190586 WormBaseID:WBGene00001791 Length:214 Species:Caenorhabditis elegans


Alignment Length:208 Identity:61/208 - (29%)
Similarity:91/208 - (43%) Gaps:45/208 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKLTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVA-RAQLSPEYLEKNPQHTVPTLEDDGHY 64
            |.|..||....|.....|::.||..|:.|||..:|:.: .::.:.|:::.||...||||..:|..
 Worm     1 MAKPILYSYWRSSCAWRVRIALALKNIDYEYRPIDLFSEESKNNAEFVKHNPAKKVPTLVINGLS 65

  Fly    65 IWDSHAIIAYLVSKYADSDALYPKDPLKRAVVDQR-------LHFESGVVFANGIRSISKSVLFQ 122
            :.:|.|||.||       |..||..|.....:|:|       ||..:.:.....| :|.|.:   
 Worm    66 LTESLAIIEYL-------DEAYPDPPFLPKELDKRSYSRAIALHIVASIQPLQAI-NIHKML--- 119

  Fly   123 GQTKVPKERYDAIIEIY-DF------------VETFLKGQD--YIAGNQLTIADFSLVSSVASLE 172
             ..|.|.         | ||            :|..||...  |..|:||||||.:|.|.:.:.:
 Worm   120 -NEKEPG---------YGDFWCNHFVNKGFLALEELLKKHSGKYCVGDQLTIADINLPSIIYNAK 174

  Fly   173 AFVALDTTKYPRI 185
            .: .:|.:|||.|
 Worm   175 IY-KVDMSKYPTI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 59/205 (29%)
GST_N_Delta_Epsilon 4..77 CDD:239343 25/73 (34%)
GST_C_Delta_Epsilon 91..209 CDD:198287 30/117 (26%)
gst-43NP_491070.1 GST_N_Zeta 4..77 CDD:239340 25/79 (32%)
maiA 5..211 CDD:273527 59/204 (29%)
GST_C_Zeta 90..207 CDD:198300 30/112 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163454
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.