Sequence 1: | NP_611328.1 | Gene: | GstE6 / 37111 | FlyBaseID: | FBgn0063494 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_497662.1 | Gene: | Y53G8B.1 / 190243 | WormBaseID: | WBGene00021817 | Length: | 213 | Species: | Caenorhabditis elegans |
Alignment Length: | 201 | Identity: | 59/201 - (29%) |
---|---|---|---|
Similarity: | 91/201 - (45%) | Gaps: | 32/201 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 VKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKYADS 82
Fly 83 DALYPKDP-LK---RAVVDQRLHFESGVVFANGIRSI-SKSVLFQGQTKVP-----------KER 131
Fly 132 YDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKLEQLP 196
Fly 197 YYEEAN 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE6 | NP_611328.1 | GstA | 4..196 | CDD:223698 | 56/193 (29%) |
GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 21/58 (36%) | ||
GST_C_Delta_Epsilon | 91..209 | CDD:198287 | 32/127 (25%) | ||
Y53G8B.1 | NP_497662.1 | Thioredoxin_like | 5..76 | CDD:294274 | 20/57 (35%) |
maiA | 18..211 | CDD:273527 | 59/201 (29%) | ||
GST_C_Zeta | 89..207 | CDD:198300 | 33/129 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160163441 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |