DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and gst-15

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_496860.1 Gene:gst-15 / 185410 WormBaseID:WBGene00001763 Length:213 Species:Caenorhabditis elegans


Alignment Length:142 Identity:42/142 - (29%)
Similarity:60/142 - (42%) Gaps:21/142 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 EKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGI 112
            :|.|...:|.|..||..|..|.||..||..|:..:.....::....|||||...|  .|.|    
 Worm    48 DKTPFGQLPVLNVDGFDIPQSAAICRYLAKKFGYAGKTPEEEAWADAVVDQFKDF--SVAF---- 106

  Fly   113 RSISKSVLFQGQTKVPKE-----RYDAIIEIYD----FVETFLK--GQDYIAGNQLTIADFSLVS 166
                |::||..:...|:|     ||:......|    .:...||  ...|:.|:.||.||..:..
 Worm   107 ----KTLLFATRAGKPEEEILKIRYEIFNPARDVYFILLNRILKKSKSGYLVGDGLTWADLVIAD 167

  Fly   167 SVASLEAFVALD 178
            ::.|||...|:|
 Worm   168 NLHSLEKLRAID 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 42/142 (30%)
GST_N_Delta_Epsilon 4..77 CDD:239343 12/28 (43%)
GST_C_Delta_Epsilon 91..209 CDD:198287 29/99 (29%)
gst-15NP_496860.1 GST_N_Sigma_like 4..77 CDD:239337 12/28 (43%)
PTZ00057 6..211 CDD:173353 42/142 (30%)
GST_C_Sigma_like 87..195 CDD:198301 29/103 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.