DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and gst-24

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_496859.1 Gene:gst-24 / 185407 WormBaseID:WBGene00001772 Length:209 Species:Caenorhabditis elegans


Alignment Length:180 Identity:46/180 - (25%)
Similarity:76/180 - (42%) Gaps:36/180 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SPEY---LEKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKY----------ADSDALYP--KD--- 89
            :||:   ..|.|...:|.|..||..|..|.||:.||..|:          |..||:..  ||   
 Worm    38 TPEWGALKPKTPFGQLPFLSVDGFEIPQSAAILRYLAKKFGYAGKTSEEEAWVDAIVDQFKDFVT 102

  Fly    90 PLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQTKVPKERYDAIIEIYD-FVETFLKGQDYIA 153
            ||::.::.||    ||  .|..|..|.|.|....:        |...:|.: .:|....|  ::.
 Worm   103 PLRQLIMAQR----SG--NAEEIERIQKEVFAPAR--------DTFFKILNGILEKSKSG--FLV 151

  Fly   154 GNQLTIADFSLVSSVASLEAFVALDT-TKYPRIGAWIKKLEQLPYYEEAN 202
            |:.:|.||..:...:.::|.....|. .:..::.|..:|:.::|..:|.|
 Worm   152 GDGVTWADLVIADILTTMEMLGVFDKHGEEQKLAALREKVNEIPEIKEHN 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 43/172 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 14/36 (39%)
GST_C_Delta_Epsilon 91..209 CDD:198287 25/114 (22%)
gst-24NP_496859.1 GST_N_Sigma_like 4..75 CDD:239337 14/36 (39%)
PTZ00057 6..208 CDD:173353 46/180 (26%)
GST_C_Sigma_like 85..191 CDD:198301 27/121 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.