DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and gst-42

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_509962.1 Gene:gst-42 / 183911 WormBaseID:WBGene00001790 Length:214 Species:Caenorhabditis elegans


Alignment Length:201 Identity:64/201 - (31%)
Similarity:95/201 - (47%) Gaps:33/201 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VKLTLAALNLTYEYVNVDIV---ARAQLSPEYLEKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKY 79
            |::.||..|:.|||..||::   |:::|.    |.||...|||...||..|.:|.|||.||...:
 Worm    20 VRIALALKNVDYEYKTVDLLSEEAKSKLK----EINPAAKVPTFVVDGQVITESLAIIEYLEETH 80

  Fly    80 ADSDALYPKDPLKRAVVDQRLHFES-GVVFANGIRSI----------SKSVLFQGQTKVPKERYD 133
            .|. .|.||||:|||      |..: .::.|:||:.:          .|...|.||  ..|:   
 Worm    81 PDV-PLLPKDPIKRA------HARAISLLVASGIQPLHNLKVLQLLNKKEAGFGGQ--FAKQ--- 133

  Fly   134 AIIEIYDFVETFLKGQD--YIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKLEQLP 196
            .::|....:|..||...  |..|:.:||||.|:...:.|...| .||.:.||.:....:.|..:|
 Worm   134 FVVEGLTALEILLKQHSGKYAVGDDVTIADLSIPPLIYSANRF-NLDLSPYPTVNRINETLADIP 197

  Fly   197 YYEEAN 202
            .:..|:
 Worm   198 AFIAAH 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 62/193 (32%)
GST_N_Delta_Epsilon 4..77 CDD:239343 26/61 (43%)
GST_C_Delta_Epsilon 91..209 CDD:198287 32/125 (26%)
gst-42NP_509962.1 GST_N_Zeta 6..77 CDD:239340 25/60 (42%)
maiA 7..211 CDD:273527 64/201 (32%)
GST_C_Zeta 90..207 CDD:198300 33/126 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.