Sequence 1: | NP_611328.1 | Gene: | GstE6 / 37111 | FlyBaseID: | FBgn0063494 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_509962.1 | Gene: | gst-42 / 183911 | WormBaseID: | WBGene00001790 | Length: | 214 | Species: | Caenorhabditis elegans |
Alignment Length: | 201 | Identity: | 64/201 - (31%) |
---|---|---|---|
Similarity: | 95/201 - (47%) | Gaps: | 33/201 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 VKLTLAALNLTYEYVNVDIV---ARAQLSPEYLEKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKY 79
Fly 80 ADSDALYPKDPLKRAVVDQRLHFES-GVVFANGIRSI----------SKSVLFQGQTKVPKERYD 133
Fly 134 AIIEIYDFVETFLKGQD--YIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKLEQLP 196
Fly 197 YYEEAN 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE6 | NP_611328.1 | GstA | 4..196 | CDD:223698 | 62/193 (32%) |
GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 26/61 (43%) | ||
GST_C_Delta_Epsilon | 91..209 | CDD:198287 | 32/125 (26%) | ||
gst-42 | NP_509962.1 | GST_N_Zeta | 6..77 | CDD:239340 | 25/60 (42%) |
maiA | 7..211 | CDD:273527 | 64/201 (32%) | ||
GST_C_Zeta | 90..207 | CDD:198300 | 33/126 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |