DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and eef-1G

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_505800.1 Gene:eef-1G / 179522 WormBaseID:WBGene00008920 Length:398 Species:Caenorhabditis elegans


Alignment Length:223 Identity:49/223 - (21%)
Similarity:87/223 - (39%) Gaps:36/223 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDSHA 70
            |||...:  .|..|:.:||     :..|..:......:|  .:|.|....|..|.|. .::.:.:
 Worm     5 LYGNKDN--FRTQKVLIAA-----KLANKTVTLAGDAAP--ADKFPLGVTPAFEGDA-LLFGAES 59

  Fly    71 IIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQTKVPKERY--- 132
            |..:|....|:::.:            |.|.|..|.:....:..:..||......|...|:|   
 Worm    60 IGLHLTGTSANAETV------------QWLQFAEGYLLPAVLGYVLPSVSAANFDKKTVEQYKNE 112

  Fly   133 -DAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAF-VALDTT---KYPRIGAWIKKL 192
             :..:::.|.|   |..:.|:.|.:|::||.|:...:  |.|| ..||..   ....:..|.:.:
 Worm   113 LNGQLQVLDRV---LVKKTYLVGERLSLADVSVALDL--LPAFQYVLDANARKSIVNVTRWFRTV 172

  Fly   193 EQLPYYEEANGK-GVRQLVAIFKKTNFT 219
            ...|..:|..|: .:...||.|.:..||
 Worm   173 VNQPAVKEVLGEVSLASSVAQFNQAKFT 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 41/197 (21%)
GST_N_Delta_Epsilon 4..77 CDD:239343 16/70 (23%)
GST_C_Delta_Epsilon 91..209 CDD:198287 27/126 (21%)
eef-1GNP_505800.1 GST_N_EF1Bgamma 3..77 CDD:239342 18/93 (19%)
GstA 4..181 CDD:223698 42/202 (21%)
GST_C_EF1Bgamma_like 71..188 CDD:198290 27/133 (20%)
EF1G 238..343 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.