DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and gst-27

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_497116.1 Gene:gst-27 / 175166 WormBaseID:WBGene00001775 Length:209 Species:Caenorhabditis elegans


Alignment Length:153 Identity:38/153 - (24%)
Similarity:63/153 - (41%) Gaps:9/153 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 KNPQHTVPTLEDDGHYIWDSHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHF-----ESGVVF 108
            |.|....|.|..||..|..|.||..||..::..:.....:.....|:|||...|     |.|...
 Worm    47 KTPFGQAPVLSVDGFEIPQSAAINRYLAKQFGYAGKTPEEQAWTDAIVDQYKDFMVSIKEVGKAS 111

  Fly   109 ANGIRSISKSVLFQGQTKVPKERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEA 173
            |.|..:.....:.|......::.:..||.  ..:|....|  ::.|:.|||||..:|..:.:|:.
 Worm   112 AAGKSAEEVGKIIQSDLVPARDAFFVIIN--KILEKSKSG--FLVGDGLTIADIVIVECITTLDK 172

  Fly   174 FVALDTTKYPRIGAWIKKLEQLP 196
            ......::.|::.|..:|:..:|
 Worm   173 HQLFTASEQPKLVALREKVYAIP 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 37/151 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 12/27 (44%)
GST_C_Delta_Epsilon 91..209 CDD:198287 26/111 (23%)
gst-27NP_497116.1 GST_N_Sigma_like 4..75 CDD:239337 12/27 (44%)
PTZ00057 6..208 CDD:173353 38/153 (25%)
GST_C_Sigma_like 85..191 CDD:198301 24/109 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.